Загрузка видео...

Не удалось загрузить видео

Возникла проблема при загрузке этого видео. Это может быть связано с временными проблемами сети или видео может быть недоступно.

На главную

🚀 Update! Our latest Pinal bioRxiv now includes wet lab results. More proteins with diverse text prompt on the way. Design proteins with just text. Everyone can do protein design! Demo: paper: GitHub:

fajie yuan

1,358 subscribers

17,069 просмотров • 1 год назад •via X (Twitter)

Здоровье и велнес Наука и технологии Образование

Anya Rossi• Live Now

Private livecam show

Комментарии: 5

Фото профиля fajie yuan

fajie yuan1 год назад

The enzyme designed by Pinal has been shown exhibited functional activity.

Фото профиля Gnarly Nutrition

Gnarly Nutrition2 лет назад

"I use Whey Protein almost daily in pancakes, smoothies, and other recipes pre and post workout, going through a lot of containers per year. I’m incredibly excited that Gnarly is pushing sustainability with their new steel containers." - Kelly Halpin

Фото профиля fajie yuan

fajie yuan1 год назад

We provided a useful tool in the Pinal interface. If you want to further optimize your protein—whether it's a natural protein or a de novo design—try SaProt-T/O. Edit your protein by conditioning partial seq, structures, w/o text. Try it here:

Фото профиля fajie yuan

fajie yuan1 год назад

DAdh248： MSLKGKNVLFVGGLGGIGLATCRALVKKNLKNLAILDIVENPEAVEELKALNPSVKVTFVKCDVTKPESIKAAFEEVKEKFGHLDVLVNGAGILDDKNIEKTIAVNLTGLINTTLAALPLMDKRKKGKGGVIVNVASVAGLEPFPAVPVYCASKHGVVGFTRSLGHPFYYELTGVKVIAVCPGITETPLLKNLGKNPLFDEFKELVEKLLKLKKQTPEECGKHIAKVIETAENGSIWKSDKGKLSELELPPWWKPPKS

Фото профиля 三千秒差距

三千秒差距1 год назад

Congratulations!

Похожие видео

Can Claude Code design proteins? We're just about to release our wet lab API + SDK so we made a quick demo to test how agents can interact with protein design models and submit the proteins to our lab for testing. This closes the loop between the computational design and the experiment validation We queued up a bunch of agent-designed proteins for wet lab validation, will release the results in a couple weeks on Proteinbase

Can Claude Code design proteins? We're just about to release our wet lab API + SDK so we made a quick demo to test how agents can interact with protein design models and submit the proteins to our lab for testing. This closes the loop between the computational design and the experiment validation We queued up a bunch of agent-designed proteins for wet lab validation, will release the results in a couple weeks on Proteinbase

Julian Englert

81,792 просмотров • 8 месяцев назад

Today in nature we present the results of our exploration of the soluble protein universe and the design of functional soluble membrane proteins with Casper Goverde Nico Goldbach Bruno Correia 1/6

Today in nature we present the results of our exploration of the soluble protein universe and the design of functional soluble membrane proteins with Casper Goverde Nico Goldbach Bruno Correia 1/6

Martin Pacesa

138,509 просмотров • 2 лет назад

Another month, another insane protein design paper from the Baker Lab. This time: Designing binders for intrinsically disordered regions, a common & important component of proteins we care about, with the help of a diffusion model In nature last week

Another month, another insane protein design paper from the Baker Lab. This time: Designing binders for intrinsically disordered regions, a common & important component of proteins we care about, with the help of a diffusion model In nature last week

Julia Bauman

45,595 просмотров • 1 год назад

“Proteins sticking to other proteins is what makes life exist.” 🧬 We explain the science behind AlphaProteo: our AI system for designing protein binders that holds huge potential for biology. ▶️ Hear from Jue Wang, co-lead of the protein design team, David La, research scientist, and Harshnira Patani, wet lab lead here at Google DeepMind. ↓

“Proteins sticking to other proteins is what makes life exist.” 🧬 We explain the science behind AlphaProteo: our AI system for designing protein binders that holds huge potential for biology. ▶️ Hear from Jue Wang, co-lead of the protein design team, David La, research scientist, and Harshnira Patani, wet lab lead here at Google DeepMind. ↓

Google DeepMind

67,589 просмотров • 2 лет назад

Nipah virus protein design competition update: The lab has been running nonstop for two weeks validating all 1,200 selected proteins. We’re now finalizing the last assays to make sure everything is properly validated, so we’re moving the results release to Wednesday, January 21st at 9am PST / 6pm CET. One thing we can say now: there are binders! 👀

Nipah virus protein design competition update: The lab has been running nonstop for two weeks validating all 1,200 selected proteins. We’re now finalizing the last assays to make sure everything is properly validated, so we’re moving the results release to Wednesday, January 21st at 9am PST / 6pm CET. One thing we can say now: there are binders! 👀

Proteinbase

12,338 просмотров • 8 месяцев назад

What seemed like an intractable problem is now possible: To design proteins with a specified nonlinear mechanical response, capturing complex folding and unfolding mechanisms in singe and few-shot computations. We present ForceGen, an end-to-end algorithm for de novo protein generation based on nonlinear mechanical unfolding responses. Rooted in the physics of protein mechanics, this generative strategy provides a powerful way to design new proteins rapidly, including exquisite and rapid predictions about their dynamical behavior. Proteins, like any other mechanical object, respond to forces in peculiar ways. Think of the different response you'd get from pulling on a steel cable versus pulling on a rubber band, or the difference between honey and glass. Now, we can design proteins with a set of desirable mechanical characteristics, with applications from health to sustainable plastics. The key to solving this problem was to integrate a protein language model with denoising diffusion methods, and using accurate atomistic-level physical simulation data to endow the model a first-principles understanding. ForceGen can solve both forward and inverse tasks: In the forward task, we can predict how stable a protein is, how it will unfold and what the forces involved are, all given just the sequence of amino acids. In the inverse task, we can design new proteins that meet complex nonlinear mechanical signature targets. Read the paper, led by LAMM@MIT postdoc Bo Ni, published in Science Advances: Why do we care about the mechanics of proteins? The mechanics of proteins are critical elements of many living systems - as evidenced in many studies of mechanobiology. Through evolution, nature has presented a set of remarkable protein materials with unique mechanical functions like elastins, silks, keratins or collagens that play crucial roles in biology. However, going beyond natural designs to discover proteins that meet specified mechanical properties remains challenging. So far, the only way to do this was to use existing evolutionary concepts or to manually alter proteins. With our new generative model we can directly design proteins to meet complex nonlinear mechanical property-design objectives. ForceGen leverages deep knowledge on protein sequences from a pretrained protein language model and maps mechanical unfolding responses to create proteins. Via full-atom molecular simulations for direct validation from physical and chemical principles, we demonstrate that the designed proteins are de novo, and fulfill the targeted mechanical properties, including unfolding energy and mechanical strength, and a detailed unfolding force-separation curves. ForceGen offers rapid pathways to explore the enormous mechanobiological protein sequence space unconstrained by biological synthesis, to enable the discovery of new protein materials with superior mechanical properties. B. Ni, D.L. Kaplan, M.J. Buehler, ForceGen: End-to-end de novo protein generation based on nonlinear mechanical unfolding responses using a language diffusion model. Sci. Adv. 10, eadl4000 (2024). DOI: 10.1126/sciadv.adl4000 Codes and model weights available Hugging Face: David Kaplan

What seemed like an intractable problem is now possible: To design proteins with a specified nonlinear mechanical response, capturing complex folding and unfolding mechanisms in singe and few-shot computations. We present ForceGen, an end-to-end algorithm for de novo protein generation based on nonlinear mechanical unfolding responses. Rooted in the physics of protein mechanics, this generative strategy provides a powerful way to design new proteins rapidly, including exquisite and rapid predictions about their dynamical behavior. Proteins, like any other mechanical object, respond to forces in peculiar ways. Think of the different response you'd get from pulling on a steel cable versus pulling on a rubber band, or the difference between honey and glass. Now, we can design proteins with a set of desirable mechanical characteristics, with applications from health to sustainable plastics. The key to solving this problem was to integrate a protein language model with denoising diffusion methods, and using accurate atomistic-level physical simulation data to endow the model a first-principles understanding. ForceGen can solve both forward and inverse tasks: In the forward task, we can predict how stable a protein is, how it will unfold and what the forces involved are, all given just the sequence of amino acids. In the inverse task, we can design new proteins that meet complex nonlinear mechanical signature targets. Read the paper, led by LAMM@MIT postdoc Bo Ni, published in Science Advances: Why do we care about the mechanics of proteins? The mechanics of proteins are critical elements of many living systems - as evidenced in many studies of mechanobiology. Through evolution, nature has presented a set of remarkable protein materials with unique mechanical functions like elastins, silks, keratins or collagens that play crucial roles in biology. However, going beyond natural designs to discover proteins that meet specified mechanical properties remains challenging. So far, the only way to do this was to use existing evolutionary concepts or to manually alter proteins. With our new generative model we can directly design proteins to meet complex nonlinear mechanical property-design objectives. ForceGen leverages deep knowledge on protein sequences from a pretrained protein language model and maps mechanical unfolding responses to create proteins. Via full-atom molecular simulations for direct validation from physical and chemical principles, we demonstrate that the designed proteins are de novo, and fulfill the targeted mechanical properties, including unfolding energy and mechanical strength, and a detailed unfolding force-separation curves. ForceGen offers rapid pathways to explore the enormous mechanobiological protein sequence space unconstrained by biological synthesis, to enable the discovery of new protein materials with superior mechanical properties. B. Ni, D.L. Kaplan, M.J. Buehler, ForceGen: End-to-end de novo protein generation based on nonlinear mechanical unfolding responses using a language diffusion model. Sci. Adv. 10, eadl4000 (2024). DOI: 10.1126/sciadv.adl4000 Codes and model weights available Hugging Face: David Kaplan

Markus J. Buehler

47,269 просмотров • 2 лет назад

Join us at NAB 2023 to experience the latest update in #PremierePro that will revolutionize your editing workflow. With Text-Based Editing, you can now create a rough cut just like copying and pasting text. Learn more about our additional updates here:

Join us at NAB 2023 to experience the latest update in #PremierePro that will revolutionize your editing workflow. With Text-Based Editing, you can now create a rough cut just like copying and pasting text. Learn more about our additional updates here:

Adobe Video

46,991 просмотров • 3 лет назад

📕 Update: June 16, 2025 Text Input Blocks Released 🎯 We'll be back with even more exciting updates in the coming weeks! ✅ Added 5 Premium Text Input Blocks w / AlignUI Design System

📕 Update: June 16, 2025 Text Input Blocks Released 🎯 We'll be back with even more exciting updates in the coming weeks! ✅ Added 5 Premium Text Input Blocks w / AlignUI Design System

Erşad

21,562 просмотров • 1 год назад

We're excited to share our latest study on how the lysosomal adaptor JIP3 and regulatory protein LIS1 activate dynein-dynactin. Out now on bioRxiv! Work done by Kashish Singh Clinton Lau Giulia Manigrasso in collaboration with Reto Gassmann lab. (1/6)

We're excited to share our latest study on how the lysosomal adaptor JIP3 and regulatory protein LIS1 activate dynein-dynactin. Out now on bioRxiv! Work done by Kashish Singh Clinton Lau Giulia Manigrasso in collaboration with Reto Gassmann lab. (1/6)

Carter Lab

82,236 просмотров • 3 лет назад

NEW EPISODE of HARD DRUGS! AlphaFold, ProteinMPNN and other AI tools are transforming biology and drug design. But how do they work? What can’t they do (yet)? And can we use them to make a vaccine against Strep A for the very first time? In this episode, Jacob and I talk about hacking proteins with AI. 03:21 What makes proteins cool 05:29 Can we make a vaccine against Strep A? 10:12 Proteins in nature aren’t enough, and we can improve them with AI 21:12 ProteinMPNN and AlphaFold are transforming drug design 29:52 A short history of protein structure prediction from physical models to deep learning 34:48 Using AI to design a Strep A vaccine 39:27 Validating an AI-designed Strep A vaccine 43:09 Recent AI protein breakthroughs 49:30 Why we don’t already have a Strep A vaccine and the future of optimizing protein drugs

NEW EPISODE of HARD DRUGS! AlphaFold, ProteinMPNN and other AI tools are transforming biology and drug design. But how do they work? What can’t they do (yet)? And can we use them to make a vaccine against Strep A for the very first time? In this episode, Jacob and I talk about hacking proteins with AI. 03:21 What makes proteins cool 05:29 Can we make a vaccine against Strep A? 10:12 Proteins in nature aren’t enough, and we can improve them with AI 21:12 ProteinMPNN and AlphaFold are transforming drug design 29:52 A short history of protein structure prediction from physical models to deep learning 34:48 Using AI to design a Strep A vaccine 39:27 Validating an AI-designed Strep A vaccine 43:09 Recent AI protein breakthroughs 49:30 Why we don’t already have a Strep A vaccine and the future of optimizing protein drugs

Saloni

72,565 просмотров • 11 месяцев назад

ok.. this is crazy OpenAI 4o now can generate and edit image with text prompt, you can change small detail like text, logo and.. it's super accurate 100% AI. 10 examples: 1. design a name card for Elon Musk, and change logo, name, phone number and colour

el.cine

319,119 просмотров • 1 год назад

Proteins are the machinery of life. Scientists have cataloged billions of protein sequences—but their biology is still mostly unknown. Today we're releasing a world model of protein biology: a scientific engine for prediction, design, and discovery that consists of ESMFold2, ESMC, and ESM Atlas. Together, they're helping to open up a new way for researchers to design proteins and speed up scientific discovery. Our mission is to cure or prevent disease. To do that, we need to accelerate science. That's why we're releasing all three openly.

Proteins are the machinery of life. Scientists have cataloged billions of protein sequences—but their biology is still mostly unknown. Today we're releasing a world model of protein biology: a scientific engine for prediction, design, and discovery that consists of ESMFold2, ESMC, and ESM Atlas. Together, they're helping to open up a new way for researchers to design proteins and speed up scientific discovery. Our mission is to cure or prevent disease. To do that, we need to accelerate science. That's why we're releasing all three openly.

biohub

79,793 просмотров • 4 месяцев назад

UI design is underrated for AI. Sometimes they go hand in hand with new model capabilities in delightful ways. Here's a very clever demo: you can use rich text (bold, font style, color) to assign different types of weights to each token, making image generation controllable in a highly intuitive & flexible fashion. Paper: Expressive Text-to-Image Generation with Rich Text HuggingFace demo: Authors: Songwei Ge, Taesung Park, Jun-Yan Zhu, Jia-Bin Huang

UI design is underrated for AI. Sometimes they go hand in hand with new model capabilities in delightful ways. Here's a very clever demo: you can use rich text (bold, font style, color) to assign different types of weights to each token, making image generation controllable in a highly intuitive & flexible fashion. Paper: Expressive Text-to-Image Generation with Rich Text HuggingFace demo: Authors: Songwei Ge, Taesung Park, Jun-Yan Zhu, Jia-Bin Huang

Jim Fan

146,921 просмотров • 3 лет назад

Turn any GitHub repository into LLM-ready text! Simply replace "hub" with "ingest" in a GitHub URL and receive a prompt-friendly text ingest for LLMs. Gitingest is 100% open-source and provides: - Directory structure - A brief summary of the project - The entire content as LLM-ready text Plus, it comes with a nice python package and you can run the UI locally! Stay tuned, I'm working on something really cool with this!✨ Link to the GitHub repo in the next tweet! _____ Find me → Akshay 🚀 ✔️ For more insights and tutorials on ML and AI Engineering!

Turn any GitHub repository into LLM-ready text! Simply replace "hub" with "ingest" in a GitHub URL and receive a prompt-friendly text ingest for LLMs. Gitingest is 100% open-source and provides: - Directory structure - A brief summary of the project - The entire content as LLM-ready text Plus, it comes with a nice python package and you can run the UI locally! Stay tuned, I'm working on something really cool with this!✨ Link to the GitHub repo in the next tweet! _____ Find me → Akshay 🚀 ✔️ For more insights and tutorials on ML and AI Engineering!

Akshay 🚀

191,449 просмотров • 1 год назад

More decks to go, but has designing beautiful slides been a pain point? Upgrades from our Presentation Agent PopAi enable prompt-based co-creation! Once you nailed the text content, leave the style design (300+ templates), layout, caption/text edits, chart and graphs to AI. Try now:

More decks to go, but has designing beautiful slides been a pain point? Upgrades from our Presentation Agent PopAi enable prompt-based co-creation! Once you nailed the text content, leave the style design (300+ templates), layout, caption/text edits, chart and graphs to AI. Try now:

Kai-Fu Lee

11,157 просмотров • 11 месяцев назад

Excited to announce our new product: AI Protein Design Copilot Tamarind Bio has been the leading provider to use the top AI tools in computational protein engineering. Today we announce a completely new way to interface with computational molecular design. Available now!

Excited to announce our new product: AI Protein Design Copilot Tamarind Bio has been the leading provider to use the top AI tools in computational protein engineering. Today we announce a completely new way to interface with computational molecular design. Available now!

Deniz Kavi

33,416 просмотров • 1 год назад

Each part of our product design process is an opportunity for progress. By joining forces with other organizations and companies, design teams are stretching beyond Google to collaborate on more sustainable results to benefit everyone. Learn more:

Each part of our product design process is an opportunity for progress. By joining forces with other organizations and companies, design teams are stretching beyond Google to collaborate on more sustainable results to benefit everyone. Learn more:

Made by Google

106,544 просмотров • 2 лет назад

$Do more with Glass → Add it to any object, shape, or text → Round individual corners → Adjust the spread of light refraction with Splay → Apply variables from your design system$

Do more with Glass → Add it to any object, shape, or text → Round individual corners → Adjust the spread of light refraction with Splay → Apply variables from your design system

Figma

1,138,652 просмотров • 8 месяцев назад

AI has solved software. Biology is the next frontier. We're hiring across every team at Adaptyv. We’ve built the best automated lab for protein designers to experimentally test their AI-designed proteins. Today, the most advanced protein design companies run their wet-lab work on Adaptyv, from the biggest biopharmas to frontier AI labs to dozens of virtual biotech startups. Demand has grown faster than we have, so we’re hiring across the board: • Bio: Research associates, scientists and lab technicians to develop and run new assays at scale. • Lab automation: Engineers and interns to onboard new lab instruments and scale our automation infrastructure. • Software: Product and backend engineers to scale LabOS, our internal lab orchestration platform, our API for agents and the data pipelines that turn messy physical-world data into clean results. • Partnerships, customer success and operations: Building partnerships with AI & pharma labs, making sure customers understand their data and can run more campaigns, making sure the company operations run smoothly

AI has solved software. Biology is the next frontier. We're hiring across every team at Adaptyv. We’ve built the best automated lab for protein designers to experimentally test their AI-designed proteins. Today, the most advanced protein design companies run their wet-lab work on Adaptyv, from the biggest biopharmas to frontier AI labs to dozens of virtual biotech startups. Demand has grown faster than we have, so we’re hiring across the board: • Bio: Research associates, scientists and lab technicians to develop and run new assays at scale. • Lab automation: Engineers and interns to onboard new lab instruments and scale our automation infrastructure. • Software: Product and backend engineers to scale LabOS, our internal lab orchestration platform, our API for agents and the data pipelines that turn messy physical-world data into clean results. • Partnerships, customer success and operations: Building partnerships with AI & pharma labs, making sure customers understand their data and can run more campaigns, making sure the company operations run smoothly

Adaptyv Bio

15,109 просмотров • 3 месяцев назад

With Google Vids, you can now create product demos by directing avatars to walk, talk, and interact with objects with just a text prompt. 🎥✨ Try it on desktop →

With Google Vids, you can now create product demos by directing avatars to walk, talk, and interact with objects with just a text prompt. 🎥✨ Try it on desktop →

Google Workspace

21,495 просмотров • 3 месяцев назад